KEGG   Helicobacter pylori 2018: hp2018_1238Help
Entry
hp2018_1238       CDS       T01914                                 

Definition
Phosphomannomutase/Phosphoglucomutase/Phosphoglu cosamine mutase (EC:5.4.2.8 5.4.2.2 5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpw  Helicobacter pylori 2018
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2018_1238
   00030 Pentose phosphate pathway
    hp2018_1238
   00051 Fructose and mannose metabolism
    hp2018_1238
   00052 Galactose metabolism
    hp2018_1238
   00500 Starch and sucrose metabolism
    hp2018_1238
   00520 Amino sugar and nucleotide sugar metabolism
    hp2018_1238
  Nucleotide metabolism
   00230 Purine metabolism
    hp2018_1238
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    hp2018_1238
Enzymes [BR:hpw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     hp2018_1238
    5.4.2.8  phosphomannomutase
     hp2018_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1260792..1262168
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEALS
AGLQSSSLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEKKPLKETPKKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMRENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLTETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPTIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETIALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgacattaggggcatttaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttggggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcagcctgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaatgctaaacatgaaaaa
aaacccctaaaagaaacgccaaagaaagtcaatgccctagaagcgtatcatcgctatttg
atcaaggattttaagcatttaaaaaatcttaaatataaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcgagaaaacgctattttgataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccttttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaagctcacagaaactaatgcacattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tacgcatgtttaagggctttggagttattgcttgaacaaagtccaagcgacttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcacaacttacaagaagcgcttaaaaacccgccaagccat
ttccctacaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaatagcgttagaatataaaagggcgttgctcaatttgttagagaagtag

DBGET integrated database retrieval system