KEGG   Helicobacter pylori 2018: hp2018_1378Help
Entry
hp2018_1378       CDS       T01914                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00900  Terpenoid backbone biosynthesis
hpw01100  Metabolic pathways
hpw01110  Biosynthesis of secondary metabolites
hpw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    hp2018_1378
Enzymes [BR:hpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     hp2018_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADZ52100
Position
1385877..1386683
Genome map
AA seq 268 aa AA seqDB search
MTHVFEVYPKVNVFLKILHKEGAYHKIISRMCLVKNKLKDIISVKNALSFSLKGDFDCPL
EENSLFKALQVLKKFLAQKNSSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHL
NQMFDCRLSLKELYTMGSLVGADTNFFISQYKSANATSYGEVIENFEEELLEDRLEIYAP
NHVSCSTKAVYQAYKPETCFSQAKEWLKKTSLECLKTYDRSELNDLLKPALRANPALKDI
ESQLSKEWFFSGSGSAFFRLKPAQRGLG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcatgtttttgaggtttatcctaaagtcaatgtttttttaaaaatccttcacaaa
gaaggggcttatcataagattatttctcgcatgtgtttagtcaaaaataagctaaaagac
attatcagcgttaaaaacgccttatctttctcattaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaagttttaaaaaaatttttagcgcaaaaaaat
tcctctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatc
cccactcaagccgggttaggcggtgggagcgctgatgctggggggctgttgtatcattta
aatcaaatgtttgattgtcgtttgagtttaaaagagctttatactatggggtctttagtg
ggcgcggacaccaattttttcatctcgcaatacaaaagcgctaacgccacttcttatggc
gaagtcattgaaaattttgaagaagagcttttagaagatcgcttagaaatctatgcgcca
aatcatgtttcttgcagcaccaaagccgtttatcaagcttataagcccgaaacttgcttt
tctcaagctaaagagtggcttaaaaaaacgagtttggaatgcctaaagacttatgacaga
agcgaactaaacgatcttttaaagccggctttacgcgctaaccctgccctcaaagatata
gaaagccaactcagtaaggagtggttttttagcggaagcgggagcgcgttttttaggcta
aagcctgctcaaagggggctaggttga

DBGET integrated database retrieval system