KEGG   Helicobacter pylori 2018: hp2018_1397Help
Entry
hp2018_1397       CDS       T01914                                 

Definition
Cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpw  Helicobacter pylori 2018
Brite
Enzymes [BR:hpw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     hp2018_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403540..1404592
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCVYALSDMDLIKKAKESQLEPMPMGKALKEYQIKKTRDVGIGAKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLIPSTIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSIPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDTEAKKIETFFEALKGKKPKIIYPEPPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcttggctttttcttgcgtttatgctttaagc
gatatggatttgattaaaaaagcgaaggaaagccagttagaacccatgcctatgggcaaa
gcgctcaaagaataccagatcaaaaaaaccagagatgtgggcattggcgctaaaaacagc
gaaatcatgacctccgctcaagtggaattgggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataacctgggcttaggtggggtggat
ctaatcccaagcaccataggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactccgtgtttaacgatgtgcagttttgggatggtagggttacgcattta
aacgaacaagcgcaagggccaatccaatcttcttttgaaatgggggctgatcctaaagtc
gtggtagaaaaaatcaattccataccaggctatgtcaagctctttagaaaagcttatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
ctcatcaccccaagccgttacgatgattttttaaggggcaatcctaaagcactcagtaag
gccgaaaaagaggggctggatttattcatttctaaaggctgtgtggcttgccataatggc
attaatcttggggggacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattctgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatacagaagcgaaaaagattgaa
accttctttgaagccttaaagggtaaaaaacctaaaataatctacccagaaccccctgtg
atgacggacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system