KEGG   Helicobacter pylori 83: HMPREF0462_0216Help
Entry
HMPREF0462_0216   CDS       T01915                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpx  Helicobacter pylori 83
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0462_0216 (hemB)
Enzymes [BR:hpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HMPREF0462_0216 (hemB)
Exosome [BR:hpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0462_0216 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(206213..207184)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDNYIKNEINSMPGVYQMSIESLL
KECEELVGLGIKAVLLFGIPKNKDATGSHALNKDHIVAKAAREVKKRFKDLIVIADLCFC
EYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKVLDKA
GYFYTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANKKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEMANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagagcgatgataagagaa
acgcgtctaaacattgatgatttcatcgctcccttatttgtcatagagagcgataattat
attaaaaatgaaatcaactccatgcctggcgtttatcaaatgagtatagagtctctttta
aaagaatgcgaagaattagtgggtttaggcatcaaagccgttttattgtttggcattcct
aaaaataaggacgctacaggaagccatgcgttaaataaggatcatattgtcgcaaaagcc
gctagagaggttaaaaaacgatttaaggatttaatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgcttctgtgtctaacgataaa
acgctagagattttaaaccttcaagggcttattttagctgaaagcggtgtggatattcta
gccccaagcaacatgatggatgggaatgttttaagcttgagaaaagtgctagataaggcc
gggtatttttacacgcccatcatgagctattccactaaatttgcgagcagttactatggg
ccttttagagatgtagcaaactctgcgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaataaaaaagaagcgcttttagaaagtttagaagatgaaaaacagggcgcg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagaaattagagat
cacactttgctccctttagcgctctataatgtgagtggggaatacgccatgctcaaactc
gctcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaaatggctaacttatta
caaaggaattga

DBGET integrated database retrieval system