KEGG   Helicobacter pylori 83: HMPREF0462_0267Help
Entry
HMPREF0462_0267   CDS       T01915                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00300  Lysine biosynthesis
hpx01100  Metabolic pathways
hpx01120  Microbial metabolism in diverse environments
hpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF0462_0267 (dapE)
Enzymes [BR:hpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HMPREF0462_0267 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEE69872
UniProt: F4D406
Position
complement(253701..254918)
Genome map
AA seq 405 aa AA seqDB search
MFCIYTSICEKTLKGFLMDALEITQKLISYPTITPKECGIFEYIKSLFPTFKALECGENG
VKNLFLYRVFNPPKEHIEEKHAKKEHAKENIKPLHFCFAGHIDVVPPGNHWQSDPFKPIV
KEGFLYGRGAQDMKGGVGAFLSASLNFNPKTPFMLSVLLTSDEEGPGIFGTRLMLEKLKE
KDLLPHMAVVAEPTCEKVLGDSIKIGRRGSINGKLILKGVQGHAAYPQKCQNPIDALASV
LPLISGVHLDDGDEYFDPSKLVITNLHAGLGANNVTPASVEVIFNARHSLKTTKESLKEY
LEKVLKSTPYTLELESSSSPFITASHSKLASVLKENILKTCHTTPLLNTKGGTSDARFFS
AHGIEVVEFGVINDRIHAIDERVSLKELELLEKVFLGVLENLSEK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcatttatacatccatttgcgaaaaaactcttaaaggatttttaatggacgct
ttagaaatcacccaaaagctcatcagctaccccaccatcacgcccaaagaatgcggtatt
tttgaatacattaaatcgctttttcctacttttaaagctctagaatgtggggaaaatggc
gtgaaaaacctttttttataccgggtttttaacccccctaaagagcatatagaagaaaag
catgcaaaaaaagagcatgcaaaagaaaatattaagcccttgcatttttgctttgcaggg
catattgatgtcgtgcctcctggaaatcattggcaaagcgatccctttaaacccattgtt
aaagaggggtttttatacggccgtggggcgcaagacatgaaaggaggcgtgggggcgttt
ttgagtgcgagtttaaattttaaccctaaaacccctttcatgctttctgttttactcaca
agcgatgaagaagggccagggatttttggcactaggcttatgttagaaaaactcaaagaa
aaagatttgctccctcacatggcggttgtggctgaacccacttgcgaaaaagtcctaggc
gatagcatcaaaatcggccgaagaggctctattaatggcaaactcattttaaaaggcgtt
caagggcatgcggcttacccacaaaaatgccaaaaccccattgatgcgctcgcttctgtt
ttgcccttgatttcaggagtccatttagacgatggcgatgaatattttgacccttcaaaa
ttggttatcaccaacttgcatgcagggttaggagcgaataatgtaacgcccgcaagcgta
gaagtcatttttaatgcgcgccattctttaaaaaccaccaaagaaagtttgaaagaatat
ttagaaaaggttttaaaaagcactccttacactttagaattagaatcaagcagttcgcct
ttcatcacggcttctcattcaaagcttgccagcgttttaaaagaaaatattttaaagaca
tgccataccaccccccttttaaacaccaaaggcggcacgagcgatgcacgattttttagc
gctcatggcatagaagtggtggaatttggcgtcattaatgataggatccatgccattgat
gaaagggtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagag
aatttgagcgagaaataa

DBGET integrated database retrieval system