KEGG   Helicobacter pylori 83: HMPREF0462_0285Help
Entry
HMPREF0462_0285   CDS       T01915                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpx  Helicobacter pylori 83
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274647..275444
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVRLVAETNQKVQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAKNKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagagatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttgtagtgagt
aaggatggtaatttaatcatagggcttagcaatatcttttttagcaataaaagcgatgat
gtgcgattagtcgcagaaaccaatcaaaaagtccaagcccttaacgccacccagcaaaat
agtgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctaaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaacttagggatcacttgaaagaaaacaccgtgagaatg
gttgtggtggggtggcttggagtcaattcagctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaagggtgtacctttctta
taccattataaggcataa

DBGET integrated database retrieval system