KEGG   Helicobacter pylori 83: HMPREF0462_0329Help
Entry
HMPREF0462_0329   CDS       T01915                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01130  Biosynthesis of antibiotics
hpx01230  Biosynthesis of amino acids
Module
hpx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0462_0329
Enzymes [BR:hpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HMPREF0462_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEE69934
UniProt: F4D4E7
Position
317557..318114
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKESMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENAHTECVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLSVFVETHKKDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagagcatg
ctttcttatgaaatgctaggtaaaagcttgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacgcccacacagaatgcgtcattgttaatttcaaaggattatacgaaataggtgcg
ccaagcgtgtttgatttagaagttttagggttattacgccgccatgcgagctctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagatgaagagcttttgaaagaagatttaaagggaatggtagaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaaaaaagactacacccattta
aaagatttaggggttttaggcgtgttagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system