KEGG   Helicobacter pylori 83: HMPREF0462_0388Help
Entry
HMPREF0462_0388   CDS       T01915                                 

Gene name
ilvC
Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00290  Valine, leucine and isoleucine biosynthesis
hpx00770  Pantothenate and CoA biosynthesis
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01130  Biosynthesis of antibiotics
hpx01210  2-Oxocarboxylic acid metabolism
hpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HMPREF0462_0388 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HMPREF0462_0388 (ilvC)
Enzymes [BR:hpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     HMPREF0462_0388 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C Rossmann-like NAD_binding_2 AdoHcyase_NAD F420_oxidored GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEE69993
UniProt: F4D4R8
Position
376696..377688
Genome map
AA seq 330 aa AA seqDB search
MALPVYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDSKVRARIGLYQGSLSASKAKA
EGFEVLEVKELVQQSDLIMALLPDELHKEVLEKEVIPFLKEGQIMGFAHGFSVHFNQVVL
PKGVGTILVAPKGPGSALREEYLKNRGLYHLIAIEQESSKNNAKAVALSYAKAMGGGRMG
VLETSFKEECESDLFGEQAVLCGGLEAIVRMGFETLIKAGYPEELAYFECVHEVKLVADL
LHYKGVEGLRKHISNTAEFGAIKNREPMGNLLEKRMQKILKKIQNGSFAKDFLLEKSLNY
PRLNTERKALKGTKIEQIGEILRAPFNHKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttggcattacccgtttattatgataaagacattgatttaggcgttatccaatctttacaa
gtgggcattattggctatggtgcgcaaggagaagcccaagcgctcaatttgagggactct
aaagtaagagcacgtattggcttgtatcaagggagtttgagcgcttcaaaagcaaaagca
gagggctttgaggtgctagaagtcaaagaattagtccaacaatctgatctgattatggca
cttcttccggacgaattgcataaggaagtgttagaaaaagaagtgatcccttttttaaaa
gaggggcaaattatgggctttgcccatggttttagcgtgcatttcaatcaggttgttctt
ccaaaaggcgtgggcacaattttagtcgcaccaaaagggcccgggagcgctttaagagaa
gaataccttaaaaataggggcttataccatttgatcgccatagagcaagaaagctcaaaa
aataacgctaaagcggtggctttaagctatgctaaagcaatgggtggggggagaatgggg
gttttagaaacgagctttaaagaagaatgcgagagcgatttattcggcgagcaagcggtt
ttgtgcggagggttagaagcgattgtgaggatggggtttgaaactttaattaaggcagga
taccctgaagaattagcctattttgaatgcgtgcatgaagtgaaattagtagcggattta
ttgcattataagggggtagagggcttaaggaaacacatttctaacaccgctgaatttgga
gcgattaaaaatagagagcctatgggaaatctcttagaaaaacgcatgcaaaaaatctta
aaaaagattcaaaacggctcattcgctaaggattttttactggaaaagagtttgaattac
cccaggttaaacacagagaggaaagcccttaaaggaactaaaatagaacaaattggggaa
attttacgcgccccattcaatcataaaaaataa

DBGET integrated database retrieval system