KEGG   Helicobacter pylori 83: HMPREF0462_0705Help
Entry
HMPREF0462_0705   CDS       T01915                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpx  Helicobacter pylori 83
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0462_0705 (galU)
   00052 Galactose metabolism
    HMPREF0462_0705 (galU)
   00500 Starch and sucrose metabolism
    HMPREF0462_0705 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0462_0705 (galU)
Enzymes [BR:hpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0462_0705 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679236..680057
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKEKALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMILLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLED
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgctgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaggcaggctgtgaagtgatggcgattgttacaggcagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagaacatcaaatccaaggcactaac
aaagaaaaagccttaaaaagcatccgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgctaaagcaaatgattttattgtatcaaaaataccaatgctccattgtagccattgaa
gaggtggcgctagaagaagtttcaaaatacggcgtgatcaggggcgaatggttagaagat
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctagccgtgatagggcgctacattttaaccccggatatttttgaaattttaagcgagacg
aaaccgggcaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcatcgcttaccaatttaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttgtaa

DBGET integrated database retrieval system