KEGG   Helicobacter pylori 83: HMPREF0462_0707Help
Entry
HMPREF0462_0707   CDS       T01915                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hpx  Helicobacter pylori 83
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpx00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680479..681747
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAATLLSQKEVKIKSLPQVVDIKAMALLLQNL
GANLEWLDPNTLQISAKSLRHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEITQLCAFLQSGGVEIEGVGSSELKIRGVENDALNLKDIQIIPDRIEAG
TYLCVGAITNSQLKIHRIIPNHIQAITDKLIEIGFSLDIQENSIEIYPAKKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSVIEETLFENRFMHASELQRLGANISLKTNIATISGS
TELTGSDVMATDLRASSALILAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVARLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaagggggggtagaaatttctggg
gcgaaaaactccgcgctccccattttagccgccacgcttttaagccaaaaggaagtcaaa
atcaaatctttaccccaagtggtggatataaaagcgatggcgttattgttgcaaaattta
ggcgctaacttagaatggcttgatcctaacacgcttcaaatcagcgccaaatccttacgc
cacactgaagccacttacgatttggtgcgtaaaatgcgcgcttccattttggttttaggc
ccactattagcgcgttttaaagaatgcttagtgagtttgcccggtgggtgcgctatagga
gcaaggccagtggatttgcacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggttatatccatgcaaaagcccctaaaggtttgaaagggaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggcagcaagcttagctaaaggg
atcacgcgcatcattaacgccgctaaagaaccagaaatcactcaattgtgcgcgttttta
cagagtgggggggtagaaattgagggcgttggcagcagtgagttaaagattaggggggtt
gaaaatgacgctttaaatttaaaagacattcaaatcatacccgataggattgaagcaggc
acttatttatgcgtgggggctatcactaacagccagcttaaaatccatcgcatcatccct
aaccatattcaagcgatcactgacaagctcatagaaattggtttttcgctagacattcaa
gaaaattctatagaaatttatccggcaaaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccgggctttcccacagacatgcaagcgcaattcatggcgttggccacgcagtgt
ttggggacgagcgtgattgaagagacgctttttgaaaaccgcttcatgcatgcaagcgaa
ctgcaacgcttgggggctaatatcagcctaaaaaccaatatcgctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcgacagatttaagggcttcttcggctctcatt
ttagccgctttagtggctaagggtgtgagtagggtgcataggatttaccacttggatagg
ggttatgagagattagaggataaaatcaacgcattaggggcaaaagttgcacgcttaaaa
gaaaaataa

DBGET integrated database retrieval system