KEGG   Helicobacter pylori 83: HMPREF0462_1121Help
Entry
HMPREF0462_1121   CDS       T01915                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00010  Glycolysis / Gluconeogenesis
hpx00020  Citrate cycle (TCA cycle)
hpx00620  Pyruvate metabolism
hpx00640  Propanoate metabolism
hpx00650  Butanoate metabolism
hpx00680  Methane metabolism
hpx01100  Metabolic pathways
hpx01120  Microbial metabolism in diverse environments
hpx01130  Biosynthesis of antibiotics
hpx01200  Carbon metabolism
Module
hpx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0462_1121
   00020 Citrate cycle (TCA cycle)
    HMPREF0462_1121
   00620 Pyruvate metabolism
    HMPREF0462_1121
   00640 Propanoate metabolism
    HMPREF0462_1121
   00650 Butanoate metabolism
    HMPREF0462_1121
  Energy metabolism
   00680 Methane metabolism
    HMPREF0462_1121
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0462_1121
Enzymes [BR:hpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0462_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AEE70725
UniProt: F4D291
Position
1126161..1126721
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIEAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgcaatcaccggcgctaaaggg
ctggctgatgtgatttcaaaaacaggtaaagaagtgcaagcgttcgcttcctatggttca
gctaaaagaggggctgctatgatggcttataaccgcgttgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctagtgattgatcccggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcaccagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattgaaaacccgcaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaatcgaggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system