KEGG   Helicobacter pylori 83: HMPREF0462_1238Help
Entry
HMPREF0462_1238   CDS       T01915                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpx  Helicobacter pylori 83
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0462_1238 (hemD)
Enzymes [BR:hpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HMPREF0462_1238 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253240..1253920
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFSYYPLKLDPTPFNALIFTSKNAVFSLLETLKNSPKLQ
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEIIPLLEKKSVLYLRAKEIAS
SLDAILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEKGIQSYTAKKPSLEACLELALSLRVKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttcctactatcccttaaaattagatccaaccccttttaacgcccttattttc
acttctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactccaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggtaaagagtttgttcaagaa
atcattcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagaaattgcctct
tctttagacgccattcttttagagcatggcattgatttcaagcaagccgttgtttatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagt
attcttatttttaccgctataagccatgcaaaagcctttttacactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttgcaagagaaaggc
attcaaagttataccgccaaaaagccctccttagaagcgtgtttagagctggctttgagt
ttgagggttaaggaatgttaa

DBGET integrated database retrieval system