KEGG   Helicobacter pylori 83: HMPREF0462_1291Help
Entry
HMPREF0462_1291   CDS       T01915                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpx  Helicobacter pylori 83
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0462_1291 (algC)
   00030 Pentose phosphate pathway
    HMPREF0462_1291 (algC)
   00051 Fructose and mannose metabolism
    HMPREF0462_1291 (algC)
   00052 Galactose metabolism
    HMPREF0462_1291 (algC)
   00500 Starch and sucrose metabolism
    HMPREF0462_1291 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0462_1291 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0462_1291 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0462_1291 (algC)
Enzymes [BR:hpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HMPREF0462_1291 (algC)
    5.4.2.8  phosphomannomutase
     HMPREF0462_1291 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304120..1305496
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRKYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAVFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKNTLLNAEHEIKPLKEIPQKVNALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGDFPNHHPDPSEAKNLQDLEQHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQETLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDEATALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gaaaagagtgcctttagtatcggcgtggagttagggaaaatcatgcgaaaatacgataaa
agcgtttttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gcggggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggtctttaatgaaatagataacatccaatgccccaattctatcatgatc
actggttctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaaaacacgcttttaaacgcagagcatgaaata
aaacccctaaaagaaataccacagaaagtcaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatataaaatcgccctagattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatggggatttccctaaccaccacccagaccctagcgaagcgaaa
aacttacaagatctagaacaacacatgcaagaaaacgctattttgataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacaatcaatacttttggcaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataatttacaagaaacgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccactccgtatttagtcagccgctttgaaggcaag
gatgaagctacagcgttagagtataaaagggcgctactcaatttgctagagaaataa

DBGET integrated database retrieval system