KEGG   Helicobacter pylori 83: HMPREF0462_1293Help
Entry
HMPREF0462_1293   CDS       T01915                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00260  Glycine, serine and threonine metabolism
hpx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01130  Biosynthesis of antibiotics
hpx01230  Biosynthesis of amino acids
Module
hpx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0462_1293 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0462_1293 (trpA)
Enzymes [BR:hpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0462_1293 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: AEE70897
UniProt: F4D2Y1
Position
complement(1306210..1306998)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYALSFEIIKTLIASGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASDKDLEQAATHSQGYIYTLARSGV
TGISHALENDASAIIKTLKAFSPTPALLGFGISKKEHIKNAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKRFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattacgcattgagttttgaaatcattaaaaccttaatt
gctagcggggtgagcgctttagaattggggtttgctttctcagatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacatgctagcatggctaaaaatttc
cagctcttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccaaatcaaacaaatctttatcgccagccctaatgcgagtgataaagat
ttagaacaagccgctacgcattcgcaaggctatatctacactttagccaggagtggggtt
acagggataagccatgctctagagaacgatgcaagcgcgatcatcaaaaccttaaaagcc
tttagccccaccccagccttactgggctttggcatttctaaaaaagaacacataaaaaac
gctaaaaacatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaatgatgaaaacgccatgctggaaaaaattaaaaggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system