KEGG   Helicobacter pylori 83: HMPREF0462_1293Help
Entry
HMPREF0462_1293   CDS       T01915                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpx  Helicobacter pylori 83
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0462_1293 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0462_1293 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0462_1293 (trpA)
Enzymes [BR:hpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0462_1293 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1306210..1306998)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYALSFEIIKTLIASGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASDKDLEQAATHSQGYIYTLARSGV
TGISHALENDASAIIKTLKAFSPTPALLGFGISKKEHIKNAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKRFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattacgcattgagttttgaaatcattaaaaccttaatt
gctagcggggtgagcgctttagaattggggtttgctttctcagatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacatgctagcatggctaaaaatttc
cagctcttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccaaatcaaacaaatctttatcgccagccctaatgcgagtgataaagat
ttagaacaagccgctacgcattcgcaaggctatatctacactttagccaggagtggggtt
acagggataagccatgctctagagaacgatgcaagcgcgatcatcaaaaccttaaaagcc
tttagccccaccccagccttactgggctttggcatttctaaaaaagaacacataaaaaac
gctaaaaacatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaatgatgaaaacgccatgctggaaaaaattaaaaggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system