KEGG   Helicobacter pylori 83: HMPREF0462_1294Help
Entry
HMPREF0462_1294   CDS       T01915                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpx  Helicobacter pylori 83
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0462_1294 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0462_1294 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0462_1294 (trpB)
Enzymes [BR:hpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0462_1294 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1307000..1308175)
Genome map
AA seq 391 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKKRIIAETGAGQHGVATAIA
CALLGLKCVVFMGAKDIKRQEMNVFRMHLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGVFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESGRAIYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEKSIIVVNLSGRGDKDLSTVYNALKGV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagaattagaacaagcgtttgatgcgtgtttgaaagatgagaaattccaa
aaagaatattttcatcttttaaaagattttgtgggccgtcctagccctttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggtggggcacataagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaaaaaggattattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtggtttttatgggggctaaagacatcaaacgccag
gaaatgaatgtttttagaatgcacttattaggcgctgaagtcagagaggttaattcaggg
agtgcgacgcttaaagacgctgtgaatgaggccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagctgccgggccacacccttaccctacgatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattctagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggggtatttagt
gcgtttttaaacgacaaagaggttaaactcataggcgtagagccagcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattacccaggagtgggaccagaacacagctatttaaaagaaagcgggcgtgcg
atttatgaaagcgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgctttaaaactcgct
caaaaatgcgaagaaaagagcatcattgtggtgaatttaagcggtcgtggggataaggat
ttaagcaccgtttataacgctttaaaaggggtttaa

DBGET integrated database retrieval system