KEGG   Helicobacter pylori 83: HMPREF0462_1295Help
Entry
HMPREF0462_1295   CDS       T01915                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01130  Biosynthesis of antibiotics
hpx01230  Biosynthesis of amino acids
Module
hpx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0462_1295 (trpC)
Enzymes [BR:hpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HMPREF0462_1295 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HMPREF0462_1295 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEE70899
UniProt: F4D2Y3
Position
complement(1308177..1309535)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSVLKKNHTLPTNINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKITKTYEKFASCISVLADSKYFLGSYKNIKMVSQHSIKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLKTDIDHTLKLRPLLPKDALIISESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDRIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCAIWQVASVMN
ANDLASKVKEASLILYDTKGDKMGGNGVSFDWGILENVKTLFMLAGGLNLDNIQKALKVK
ALGLDFNSGLETSPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtctctgtgcttaaa
aaaaatcacactttaccgacaaacataaacccaagcgatagggattttaaaaaggcgtta
ctggaaaaaaagaccagttttattctagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttgaaaataaccaaaacttatgaaaaattcgcctcttgc
atttcggttttagccgattctaaatattttttaggctcttataaaaacattaagatggtt
tcgcaacattccattaagcccattttatgcaaagattttatcattgatgcttttcagatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgttaagcgtattagatgat
aagaattatttagagcttttcaacctcgctaaatccttaaacatgagcgtgctgactgaa
gtttccaaccagcaagaaatcaagcgcttgctcaaactccaatacgacattatcggcatc
aataacagggatttacacaccttaaaaaccgatattgaccacacgctcaaattacgcccc
cttttgcctaaagacgcgctcattatcagcgagtccggtatttattcgcatgcgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggtagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
agaattaaagacgctaaagccgtttataaaaaccattttatttatggaggtttgattttt
gaaaaatcttcgccaagatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataggattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggctattcacaacaagaaatcgct
caattaaaaaaatcgctccctaaaacttgtgcgatttggcaagtagcgagtgtgatgaac
gctaacgatttggcgtctaaagttaaagaagcctctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattgggggattttagaaaatgtcaaaacg
cttttcatgttggctggtgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattccggtttagaaacaagccctgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system