KEGG   Helicobacter pylori 83: HMPREF0462_1442Help
Entry
HMPREF0462_1442   CDS       T01915                                 

Gene name
ccpA
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpx  Helicobacter pylori 83
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1437527..1438579
Genome map
AA seq 350 aa AA seqDB search
MKKSVLLGVCLAFSCAHALNDMDLIKKARESQLEPMPMGKALKEYQIKKTKDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
TKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALKGKKPKILYPELPIMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatccgttttattgggcgtttgcttggctttttcttgcgctcatgctttaaac
gatatggatttgatcaaaaaagcgagggaaagccaattagagcctatgcctatgggcaaa
gcgctcaaagaataccagattaaaaaaactaaagatgtgggtattggcaccaaaaacagc
gagattatgacccccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataacctgggcttaggcggggtggat
ttagtcccaagcgctgtaggctctcaatggaagaaaaaccctcaccttttaagctcccca
acggtgtataactctgtgtttaatgatgtgcagttttgggatgggagggttacgcattta
aacgaacaagcgcaagggcccatccagtcttcttttgaaatgggggctgatccaaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaactctttagaaaagcttatggc
actaaagtcaaaattgattttaaattgatcgcagatagtatcgctatgtttgaagccacg
cttatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaag
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattttgggatgtcaaggatgcgatcaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagccttaaagggtaaaaaacctaaaatactctatccagaactccctata
atgacagacaaaaccccaaaaccctctttttga

DBGET integrated database retrieval system