KEGG   Helicobacter pylori 83: HMPREF0462_1538Help
Entry
HMPREF0462_1538   CDS       T01915                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00220  Arginine biosynthesis
hpx00330  Arginine and proline metabolism
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01130  Biosynthesis of antibiotics
hpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HMPREF0462_1538 (rocF)
   00330 Arginine and proline metabolism
    HMPREF0462_1538 (rocF)
Enzymes [BR:hpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HMPREF0462_1538 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEE71142
UniProt: F4D4B3
Structure
PDB: 

Jmol
Position
complement(1549656..1550624)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIVQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRKNLQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLRAVEVTEYNPTVSAKHTDEEEKQVLE
ILDLIINSCKIKDKKPSFTMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagccttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acaatcgttcaagagcggtgcgtgctttataaagaatttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgaaaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggttcaatcgcatgagcgagagcgaagagaaggcatggcaa
aaactctgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggagtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagaaaaaacttgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttacctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgagctaaag
caattactgggcttgcttttagaaagttttaaagacagattaagagccgttgaggtaacc
gaatacaaccccacggtgagcgcaaaacacaccgacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagacaagaagccatcttttacaatg
agtcgctga

DBGET integrated database retrieval system