KEGG   Helicobacter pylori 26695: HP0112Help
Entry
HP0112            CDS       T00008                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpy  Helicobacter pylori 26695
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HP0112
Enzymes [BR:hpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HP0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
119980..120675
Genome map
AA seq 231 aa AA seqDB search
MTQALYYFIIYLLLKKLVIMINMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISA
RIGANQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAY
ARPPYSLAYSLRHNRLLPRDYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKY
FVFIKGCGIFAYHRELSKLMEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcaagctctttactattttattatctatcttttattaaaaaaacttgttatcatg
ataaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaaagc
atttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttcagca
cgcattggcgcaaatcaatttgtgatcaacaaaagaaacgctgtttttgatcaattgaat
gaaaacaccttactggttttgcatgacaaaatagattaccgctggaaagaagcgagcttg
gattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgcttac
gcgcgccctccttatagtttggcgtattccttgcgccacaaccgattgctccctagagat
tatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactatgac
agctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaatat
tttgttttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactcatg
gaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatggat
tattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system