KEGG   Helicobacter pylori 26695: HP0163Help
Entry
HP0163            CDS       T00008                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpy  Helicobacter pylori 26695
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hpy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(171427..172398)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMLRETRLNIDDFIAPLFVIESDSCIKNEISSMPGVYQMSMEPLL
KECEELVGLGVKAVLLFGIPKHKDATGSHALNKDHIVAKAAKEIKKRFKDLIVIADLCFC
EYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDNA
GYTHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagggcaatgctaagagaa
acgcgtctaaatattgatgatttcatcgctcccttatttgtcatagaaagcgatagttgt
attaaaaatgaaatcagttccatgcctggcgtttatcaaatgagcatggagcctctttta
aaagaatgcgaagaattagtgggtttaggcgtcaaagccgttttattgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaacaaggatcatattgtcgcaaaagcc
gccaaagagattaaaaaacgattcaaggatttaatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgcttctgtgtctaacgataaa
acgctagagattttaaatcttcaagggcttattttagctgaaagcggtgtggatattcta
gccccaagcaacatgatggatggcaatgttttaagcttgaggaaaacgctagataacgcc
ggctatacccacacgcccatcatgagctattccactaaatttgcgagcagttactatggg
ccttttagagatgtagccaattctgcgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaatcaaaaagaagcgcttttagaaagtttagaagatgagaaacagggcgcg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagaaattagagat
cacactttgctccctttagcgctctataatgtgagcggggaatacgccatgctcaaactc
gctcaaaaacacaacctgatcaactatgaaagcgttttattggaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system