KEGG   Helicobacter pylori 26695: HP0194Help
Entry
HP0194            CDS       T00008                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpy  Helicobacter pylori 26695
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HP0194 (tpiA)
   01230 Biosynthesis of amino acids
    HP0194 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HP0194 (tpiA)
   00051 Fructose and mannose metabolism
    HP0194 (tpiA)
   00562 Inositol phosphate metabolism
    HP0194 (tpiA)
Enzymes [BR:hpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HP0194 (tpiA)
Exosome [BR:hpy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HP0194 (tpiA)
  Exosomal proteins of bladder cancer cells
   HP0194 (tpiA)
  Exosomal proteins of melanoma cells
   HP0194 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
200992..201696
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFFGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRTLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLSEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgacagggtgtttgtattc
cctgatttttttgggttattgcctaattcgtttttgcatttcactttaggggtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ctcaaaatccacacgcttttaatagggcatagcgagaggcgaacgcttttaaaagaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgtattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatctcaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaatcttaaatcaaaaaacgcccttgttgtatggggggagcgtgaacaca
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system