KEGG   Helicobacter pylori 26695: HP0339Help
Entry
HP0339            CDS       T00008                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hpy  Helicobacter pylori 26695
Brite
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HP0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
350692..351042
Genome map
AA seq 116 aa AA seqDB search
MDSEGFSPSIYTDKTGHPTIGYGYNLSVYSYEGKRITKTYGLLTDILSYGWYKNLDAMRR
MVILDLSYNLGLNGLLKFKQFIKAIEDKNYALAVERLQKSPYFNQVKKERQGIWKF
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtggattcagaggggttttcgccttctatttataccgacaagacagggcatcccacgatt
ggctatggctataatttgagcgtttattcttatgagggtaagcgtatcaccaaaacatat
gggcttttaactgacatactctcttatgggtggtataaaaatttggacgcaatgaggaga
atggtcatcttggatttgagctacaatttaggcttgaacggactgctcaaattcaagcaa
ttcatcaaggccatagaggataaaaattatgctttggctgtggagagactgcaaaaaagc
ccgtatttcaatcaagtgaaaaaagagcgtcaaggaatatggaaattttga

DBGET integrated database retrieval system