KEGG   Helicobacter pylori 26695: HP0363Help
Entry
HP0363            CDS       T00008                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hpy  Helicobacter pylori 26695
Brite
Enzymes [BR:hpy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HP0363 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 NodS Peptidase_S24 Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 900271
NCBI-ProteinID: NP_207161
UniProt: P56133
Position
complement(372965..373594)
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEINKRFNLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLDNVHVKFADGNKGWEQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtattaaaaaccatttaatgtgtgaagaaatcaataagcgtttcaatttgcac
cccaaagtgagagaggctatggagagcattgaaagagaagtttttgtgccagcccccttt
aaacattttgcctacactttaaacgctctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggttttgtctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtttagacaatgttcatgttaaattcgctgatgggaacaagggctgggagcaatacgcc
ccttatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgctgattgat
cagcttgaagaaggcgggatattagtcgcacccattcaagaaaacaacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcgcgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system