KEGG   Helicobacter pylori 26695: HP0377Help
Entry
HP0377            CDS       T00008                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpy  Helicobacter pylori 26695
Brite
Enzymes [BR:hpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HP0377
Secretion system [BR:hpy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HP0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
385340..386005
Genome map
AA seq 221 aa AA seqDB search
MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSY
AGLEDVFSDNKSISPNDKYMLLVFGRNGCSYCERFKKDLKNVKELRDYIKEHFSAYYVNI
SYSKEHDFKVGDKNNEKEIKMSTEELAQIYAVQSTPTIVLSDKTGKTIYELPGYMPSTQF
LAVLEFIGDGKYQDTKDDEDLTKKLKAYIKYKTNLSKSKSN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttttcactttcttatgtttccaagaaatttttaagcgttttattattgatttcgctg
tttttaagcgcttgcaaatccaacaataaagacaagttagacgaaaatcttttaagctct
ggctctcaaagctccaaagaattaaacgatgagcgagacaatatagacaaaaagagttac
gctggtttagaagatgttttttcagacaataagtccattagtcctaacgataaatacatg
cttttagtttttggccgtaatggttgctcctattgcgaaaggtttaaaaaagatctcaaa
aatgtcaaagaattgcgcgactacattaaagagcattttagcgcttactatgtcaatatc
agctactccaaagagcatgattttaaagtcggcgataaaaataatgaaaaagaaatcaaa
atgtccacagaagaattagcgcaaatttatgccgtccaatccacccctacgattgtttta
tccgataaaaccggcaaaaccatctatgaattgcccggctatatgccctctacgcaattt
ttagccgtgttagaatttatcggcgatgggaagtatcaagacacaaaagacgatgaggat
ctcactaaaaaattaaaggcttacatcaagtataaaaccaacctttctaaaagcaagtct
aactag

DBGET integrated database retrieval system