KEGG   Helicobacter pylori 26695: HP0499Help
Entry
HP0499            CDS       T00008                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hpy  Helicobacter pylori 26695
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HP0499
   00565 Ether lipid metabolism
    HP0499
   00590 Arachidonic acid metabolism
    HP0499
   00591 Linoleic acid metabolism
    HP0499
   00592 alpha-Linolenic acid metabolism
    HP0499
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HP0499
    3.1.1.32  phospholipase A1
     HP0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
525424..526491
Genome map
AA seq 355 aa AA seqDB search
MKSILLFMIFVVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNSWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTDWFQIYNDPQSAPMRMMNFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGQPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKIDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattttgctctttatgatttttgtagtttgtcagttagaaggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgcaaacaggatttgcacatc
attaaaacgcaaaacgatttgtccaattcttggtatctccctccacaaaaagcccccaaa
gaacattcttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tattttctgcctttttatcatagtttcacccccatttttcaatggtaccaccccaatatc
aacccgtatcaacgcaatgagtttaagttccaaattagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctgtatttagcttatacccaaactgactggtttcaa
atttacaatgacccccaatccgctcccatgcgaatgatgaatttcatgcctgaactcatt
tatgtttatcctatcaattttaaaccttttgggggtaaaatagggaatttttctgaaatt
tggataggttggcagcacatttctaatggcgtggggggcgcgcaatgttaccaacctttt
aataaagaaggcaatcctgaaaaccagtttccaggacaacctgtaatcgttaaagattat
aatgggcaaaaagatgtgcgctggggggggtgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggcctaaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaatcctaatttgattgattacatggggtatggtaacgctaaa
attgattacaggagagggcgccaccattttgaattgcagctttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctatcgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttaaacccttaa

DBGET integrated database retrieval system