KEGG   Helicobacter pylori 26695: HP0535Help
Entry
HP0535            CDS       T00008                                 

Definition
(RefSeq) cag pathogenicity island protein cag14
  KO
K12099  
cag pathogenicity island protein 14
Organism
hpy  Helicobacter pylori 26695
Pathway
Epithelial cell signaling in Helicobacter pylori infection
Module
Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HP0535
Secretion system [BR:hpy02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HP0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(567142..567522)
Genome map
AA seq 126 aa AA seqDB search
MLPTKTRIRDPNKQELTQPKIKGLIMGKILASLLGGGTNLFTGLSSDLFSMILNFLFFLM
LMMGLNEILGKKFNLPMDNIKNFMAEVLKNGFDSIKNMGSALVGNGFGSNKSDKTTNKMS
VSQVRL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctactaaaacacgcattagagatccgaacaagcaagaacttacacaaccaaaa
ataaaaggactgatcatgggaaaaattttagcttctttgttgggtggcggaacaaatctt
tttacaggtttatccagtgatttgttttctatgatattaaattttttgttcttcctgatg
ttaatgatgggacttaatgaaatattagggaaaaaattcaacttgcctatggacaatatc
aagaattttatggcagaagtgttgaagaatggattcgatagtatcaaaaacatgggatct
gctttggttggtaatggttttggtagcaacaaatcagacaaaaccactaataaaatgagt
gtctctcaagtaagactctag

DBGET integrated database retrieval system