KEGG   Helicobacter pylori 26695: HP0592Help
Entry
HP0592            CDS       T00008                                 

Definition
type III restriction enzyme R protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpy  Helicobacter pylori 26695
Brite
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HP0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623167..626172
Genome map
AA seq 1001 aa AA seqDB search
MGCVFTNFRLRRSQTPKAKTPMIFEKQDYQQECIYNIITLLDGFDFKRHDALNLKDCLNQ
FHAACEIPVKNVSGKLNVDVLMETGTGKTFTYLNLIFALHKAYGQNKFIIFVPRKAILES
VKQNIRLTKDYFYLEFKRHLKTYTYEGVKSPSNIINHYIKNQDELSVLLLTNSAIDKEGN
ILNKNSENLFNTKSIFENIADLKPISIIDEPHLLKGEAFGKYFGKIGALYFRFGATFAKE
KEHALSNVAFCLDSISAFRNYLVKQIRIHSVMQDAQSPFLLNADSKSAKIAFYKAGILKQ
ITLSKGEDLGKINASFNGVSLVKTAKDKAYLSNGATLEKASYKLAQDEISALLEKAIDLH
FEKEAFLFDQNIKALSLFFIPKIEDFRQIDNKGTPFIKTEFERLYKLKRASILARENLSP
SYKEYLKRDFDESGNLRVHQGYFSGDSVALNKGKKESKKEDIEANDIKMILSEKEKLLSF
QTPLRFIFSVWALQEGWDNPNIFTLIKLANSTSETSRHQQVGRGLRIAINQEGKRVTHGF
LKGNDNAFYKINYLDMLVSGEEVGFIEGLQKEIEASSFIGGGNALDREDLAKLGLNEREI
NKLFVELENSNALEFDETNNAYKIIAPICETMQNNEERIKDFLSDEEYHAVLSAFKMAEN
PTNKRDQIINANQPQEKVKIRQNLAKEFKELWQTINAQSQLSYQNIQKTKLIESIAKAFN
ESHVSAEVIKFESKRYDPQTNRIITEQSSTLKIRDYANALQKEINALLLDFAKDERLPLK
FTLELYNALNKEHFTNSPKKAFKLLKGIIKDKLHENLLSCVSYGFCQNAFSNTAFDKTDP
LYCEDGSPKNEIEKHKIGKYKSAQTPSPNYLYETIIYDSKIEEEVSEEGVQTLEGKSIEV
FAKLPKFKIPTPYKNYEPDFAYLLKDEKGAKIFFVCETKGYEKESDIPPDEKRKIEYAKK
FFETLSQNLKNAKKEIRVVFATRINKQDLFNTLKNALKETP
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
ttgggttgcgtttttaccaatttcagattaagacgctcgcaaacaccaaaggcaaaaaca
ccaatgatttttgaaaagcaagactaccaacaagagtgtatctacaatatcatcacgctt
ttagacggctttgattttaagcgccacgatgccttaaatctaaaagattgtttaaatcaa
tttcatgctgcatgcgaaattcctgtcaaaaatgtaagcggcaagctcaatgttgatgtt
ttgatggaaacaggcacgggcaaaactttcacttacttgaatttgatctttgcactccat
aaggcttatgggcaaaataaattcatcatctttgtcccacgaaaagccattttggagtcg
gttaagcaaaatatccgccttacgaaagattatttttatttagaattcaaacgccacctg
aaaacctacacttatgaaggggttaaatcaccaagcaacattatcaatcattacattaaa
aaccaagatgaactgagcgtcttgctcctcactaacagcgcgattgacaaggagggaaac
atactcaataaaaacagcgaaaacctttttaacaccaaaagcatttttgaaaatatcgct
gatttaaagcctatttctatcatagacgagccgcatttgcttaagggtgaagcgtttggt
aagtattttggtaaaataggcgcgctttattttcgctttggggcgacttttgccaaagaa
aaagagcatgctttaagcaatgttgccttttgtttggattcaatcagcgcgtttagaaat
taccttgtcaaacaaatccgcatccattctgtcatgcaagatgcgcaaagcccgtttttg
ctcaatgcggattcaaaaagcgcaaaaattgccttttacaaagcgggcattcttaaacaa
atcacgctttcaaagggagaggatttaggcaaaattaacgcttcttttaacggcgttagt
ttggttaaaaccgccaaagacaaggcttatttgagtaatggcgctacgcttgaaaaggct
tcttataaactcgcgcaagatgaaatcagcgctcttttagaaaaagccattgatttgcat
tttgaaaaagaggcgtttttatttgatcaaaacattaaagcgttaagtctgttttttatc
cccaaaattgaggattttaggcaaattgataacaaaggcacgccctttattaaaaccgaa
tttgaaaggctttacaaactcaaacgcgcttcaattctagcaagggaaaatttatcgcca
agctataaagaatatttgaaaagagattttgatgagagcggtaatttacgcgtccatcaa
ggctattttagcggcgatagcgtagcgctcaataaaggcaaaaaagaaagcaaaaaagaa
gacattgaagccaacgacattaaaatgattttaagcgaaaaagaaaaactgctttcattt
caaacgcctttgcgttttatttttagcgtgtgggctttgcaagagggctgggataatcca
aacatttttacccttattaaactggcaaattctaccagcgaaaccagccgccatcagcaa
gtggggcgcgggttaagaattgcgattaatcaagagggcaagcgcgttacgcatggattt
ttaaaaggcaatgacaacgctttttataaaataaactaccttgatatgttagtgagtggc
gaagaagtgggctttatagagggtttgcaaaaagagattgaagcgagcagctttattggt
ggtggcaacgcgctagacagagaggatttagccaagttagggcttaatgaaagagagata
aataaacttttcgttgaattagaaaattcaaacgccctagaatttgacgaaaccaacaac
gcttacaaaatcattgcccctatttgtgagacgatgcaaaacaatgaagaaaggataaaa
gactttttaagcgatgaagaataccacgccgttttaagcgcctttaaaatggctgaaaat
ccaaccaacaagcgcgatcaaattataaacgctaaccaacctcaagaaaaagttaaaatc
cgccaaaatttagctaaggaatttaaagagttgtggcaaaccatcaacgcgcaaagccaa
ttaagctatcaaaatatccaaaaaaccaagctgatagaatctatcgccaaagcgtttaat
gagagccatgtgagtgctgaggtaatcaaatttgaaagcaaaaggtatgacccacaaacc
aacaggatcatcacagagcaatcaagcaccttaaaaatcagagactacgctaacgcttta
caaaaagaaatcaacgcgcttttgcttgactttgccaaagatgagcgcttacccttaaaa
ttcacgcttgaactctacaacgctttaaacaaagagcatttcacaaactcacccaaaaaa
gcctttaaattgcttaaaggcatcattaaagataagttgcatgaaaacttgctttcttgc
gtgagttatggattttgccaaaacgccttttctaacacggcttttgataaaaccgatccg
ctttattgtgaagatggctcgcccaaaaatgagattgaaaaacacaaaataggcaaatac
aaaagtgcgcaaactccaagcccaaactatctttatgagacgatcatttatgattctaaa
attgaagaagaagtgagtgaagagggggtgcaaacactggaaggtaaaagcatagaagtt
tttgccaagctccctaaatttaaaatcccaacgccttataaaaactatgagcctgatttt
gcttatttgcttaaagatgaaaagggtgcaaaaatcttttttgtttgcgaaaccaaaggt
tatgaaaaagaaagcgacatcccgccagatgaaaagcgtaaaattgaatacgctaagaaa
ttttttgaaacgctatctcaaaatttaaagaacgcgaaaaaagaaatacgagtcgttttt
gccacacgcattaacaaacaagatttattcaacacgcttaaaaacgcattaaaggaaacg
ccatga

DBGET integrated database retrieval system