KEGG   Helicobacter pylori 26695: HP0925Help
Entry
HP0925            CDS       T00008                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hpy  Helicobacter pylori 26695
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
988604..989185
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CSSCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaagtccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgctaaaaatcacgcacgctttagagaacgccctagaaaaccttaaaaca
tgttcatcttgtaacgcgctcagcgagagtgaggtttgtgagatttgctctgatgaaagc
cgacaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaagat
ttaaaggattttttagggcgctattatgtgttaaactccatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttagctaatgattctctaatgctttatattgaagacaaattacagcatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system