KEGG   Helicobacter pylori 26695: HP1108Help
Entry
HP1108            CDS       T00008                                 

Gene name
porC, porG
Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hpy  Helicobacter pylori 26695
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hpy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hpy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hpy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hpy00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hpy00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hpy00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1170138..1170698
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggtgcaatcactggcgctaaaggg
ttggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcttatggttca
gctaaaaggggggctgctatgatggcttataaccgcgttgatgatgaacctatcttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgaccctggtttggttttcatt
gaaaacatcttcgccaatgaaaaagaagacacgacttatattatcactagctaccttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgttaggg
gcgttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system