KEGG   Helicobacter pylori 26695: HP1205Help
Entry
HP1205            CDS       T00008                                 

Gene name
tuf
Definition
elongation factor Tu (EC:3.6.5.3)
Orthology
K02358  
elongation factor Tu
Organism
hpy  Helicobacter pylori 26695
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1280679..1281878)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRPTQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaacagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcgcaaatggac
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaactagggagcatatc
ttattgtctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagaacttgtagaaatggaagtgcgcgaattgttgagcgcg
tatgaatttcctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggtaatgtgggtgaatggggtgaaaaagtgcttaaacttatggctgaa
gtggatgcctatatccctactccagaaagagacactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagagggactgtggttacaggtaggattgaaagaggc
gtggtgaaagtaggcgatgaagtggaaatcgttggtatcagacctacacaaaaaacgact
gtaaccggtgtagaaatgtttaggaaagagttggaaaaaggtgaagccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtggaacgcggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttctaaagaa
gaaggcgggagacacactccattcttcaccaattaccgcccgcaattctatgtgcgcaca
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgtgaaaatcactgtagagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system