KEGG   Helicobacter pylori 26695: HP1224Help
Entry
HP1224            CDS       T00008                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpy  Helicobacter pylori 26695
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hpy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1300376..1301056
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
MLQNIPAYALSEPTAKTLQDHHFKVAFMGEKAHGKEFVQEIFPLLEKKSVLYLRAKEIVS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIPSYIAKKPSLEACLELALSLRIKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatctta
aatgaattttgctactatcccttagaattagatccaaccccttttaacgccttgattttc
acctctaaaaatgcggtattttccttgctagaaactctaaaaaacagccccaaactcaaa
atgttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttatgggggaaaaagcccatggcaaagagtttgttcaagaa
atctttcctttattggaaaaaaaaagcgttttgtatctcagggcgaaagagattgtctct
tctttagacaccattcttttagagcatggcattgatttcaagcaagccgttgtctatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagt
attcttatttttaccgctataagccacgcaaaagcctttttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttacaagaacaaggc
attccaagctatattgccaaaaagccctccttggaagcgtgtttagaactggctttgagt
ttgagaattaaggaatgttaa

DBGET integrated database retrieval system