KEGG   Helicobacter pylori 26695: HP1275Help
Entry
HP1275            CDS       T00008                                 

Gene name
algC
Definition
(RefSeq) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00010  Glycolysis / Gluconeogenesis
hpy00030  Pentose phosphate pathway
hpy00051  Fructose and mannose metabolism
hpy00052  Galactose metabolism
hpy00230  Purine metabolism
hpy00500  Starch and sucrose metabolism
hpy00520  Amino sugar and nucleotide sugar metabolism
hpy00521  Streptomycin biosynthesis
hpy01100  Metabolic pathways
hpy01110  Biosynthesis of secondary metabolites
hpy01120  Microbial metabolism in diverse environments
hpy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HP1275 (algC)
   00030 Pentose phosphate pathway
    HP1275 (algC)
   00051 Fructose and mannose metabolism
    HP1275 (algC)
   00052 Galactose metabolism
    HP1275 (algC)
   00500 Starch and sucrose metabolism
    HP1275 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HP1275 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HP1275 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HP1275 (algC)
Enzymes [BR:hpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HP1275 (algC)
    5.4.2.8  phosphomannomutase
     HP1275 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 898879
NCBI-ProteinID: NP_208067
UniProt: O25865
Position
1350206..1351585
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKGAFSIGVELGKIMRECDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKEIPEKANALEAYQRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFNSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQETLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gagaagggggcttttagtatcggtgtggagttggggaaaatcatgcgagaatgcgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcgggactgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcagcctttaatgaaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaaccaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaacgcaaagcatgaaata
aaacccctaaaagaaataccagagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttaaacatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttaatagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggataggattgcgatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctacaagaaacgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagtattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgtgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaagggcgttgctcaatttattagaaaaactttaa

DBGET integrated database retrieval system