KEGG   Helicobacter pylori 26695: HP1278Help
Entry
HP1278            CDS       T00008                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpy  Helicobacter pylori 26695
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HP1278
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HP1278
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HP1278
Enzymes [BR:hpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HP1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1353148..1354329)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLNLKCVVFMGSKDIKRQEMNVFRMHLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKESGRAVYESASDAEALEAFKLLCQKEGIIPALESSHALAYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcggagttgttagtg
cctgcattaagagaattagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcgtcttttaaaggattttgtgggccgtcctagccctttaaccttgtgt
caaaatatcgtttctaaccctaaagtcaagctttatttaaaacgagaggatttaatccat
ggcggggcgcataagactaatcaagccttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggatcatcgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcattattgaacttaaaatgcgtggtttttatgggatctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcacttattaggcgctgaagtgagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagagattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccagattttagaaaaagaaaaccgc
ttgcctgattatgtgatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcatttttaaacgacaaagaagttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagaaagtgggcgtgcg
gtttatgaaagcgcaagcgatgctgaagcgctagaagccttcaagttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgccttagcgtatgccttaaagctcgct
caaaaatgcgaagaagaaagcatcatcgtagtgaatttaagcggcagaggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system