KEGG   Helicobacter pylori 26695: HP1399Help
Entry
HP1399            CDS       T00008                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00220  Arginine biosynthesis
hpy00330  Arginine and proline metabolism
hpy01100  Metabolic pathways
hpy01110  Biosynthesis of secondary metabolites
hpy01130  Biosynthesis of antibiotics
hpy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HP1399
   00330 Arginine and proline metabolism
    HP1399
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HP1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 899897
NCBI-ProteinID: NP_208190
UniProt: O25949
Structure
PDB: 

Jmol
Position
1459926..1460894
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIRELQIPLFSVDAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKAVEVTEYNPTVSIKHNNEEEKQVLE
ILDLIINSCKIKDKKHSFARSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcagagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttaagcgccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgaaaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagtgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattagggaattgcaaatc
cctttatttagcgtggatgcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatttggacattatggatggc
aagcttttcacttctaccggtgtgcgtgaaaataacgggctgagttttgatgagctcaag
caattactgggtttgcttttagaaagttttaaagaccgattaaaagcggttgaggtaacc
gaatacaaccccacggtgagtataaaacacaataacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagcactcttttgcaagg
agttactga

DBGET integrated database retrieval system