KEGG   Helicobacter pylori 26695: HP1399Help
Entry
HP1399            CDS       T00008                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpy  Helicobacter pylori 26695
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hpy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1459926..1460894
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIRELQIPLFSVDAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKAVEVTEYNPTVSIKHNNEEEKQVLE
ILDLIINSCKIKDKKHSFARSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcagagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttaagcgccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgaaaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagtgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattagggaattgcaaatc
cctttatttagcgtggatgcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatttggacattatggatggc
aagcttttcacttctaccggtgtgcgtgaaaataacgggctgagttttgatgagctcaag
caattactgggtttgcttttagaaagttttaaagaccgattaaaagcggttgaggtaacc
gaatacaaccccacggtgagtataaaacacaataacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagcactcttttgcaagg
agttactga

DBGET integrated database retrieval system