KEGG   Helicobacter pylori 26695: HP1443Help
Entry
HP1443            CDS       T00008                                 

Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00900  Terpenoid backbone biosynthesis
hpy01100  Metabolic pathways
hpy01110  Biosynthesis of secondary metabolites
hpy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HP1443
Enzymes [BR:hpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HP1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 899851
NCBI-ProteinID: NP_208234
UniProt: O25984
Position
1514781..1515587
Genome map
AA seq 268 aa AA seqDB search
MTHVFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSTDAGGLLYHL
NQIFDWRLSLEELYSMGSLVGADTNFFISQYKSTNATSYGEVIENFEEEPLENRLEIYAP
NHVFCSTKAVYQAYKPETCFSQAKEWLKKPSLECLKTYDRNGLNDLLKPALLTNQALKDI
ESELGKEWFFSGSGSAFFRLKPMQKGGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcatgtttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttaccacaagcttatttctcgcatgtgtttggtcaaagacaagctcaaagac
attatcagcgtcaaaagcgcgctttctttttcgttaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaat
ttctctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatc
cccactcaagccggattaggcggtgggagcactgatgctggggggctattgtatcattta
aatcagatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtg
ggcgcggacaccaattttttcatctcgcaatacaaaagcactaacgccacttcttatggc
gaagtcattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcacca
aatcatgttttttgcagcaccaaagccgtttatcaagcttataagcctgaaacttgtttt
tctcaagctaaagaatggcttaaaaagccgagtttggaatgcctaaaaacttatgataga
aacggattaaacgaccttttaaagccggctttactcactaaccaagccttaaaagatata
gaaagcgaactaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggcta
aagcctatgcaaaaagggggcgaatga

DBGET integrated database retrieval system