KEGG   Helicobacter pylori 26695: HP1461Help
Entry
HP1461            CDS       T00008                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpy  Helicobacter pylori 26695
Brite
Enzymes [BR:hpy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HP1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1532694..1533746
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCAHALNDLELIKKARESQLEPMPMGKALKEYQIKKTRDVGIGTKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLNLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFGALRGKKPKIIYPELPIMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcttggctttttcttgcgctcatgccctaaac
gatttagaattgatcaaaaaagcgagggaaagccagctagaacccatgcctatgggcaaa
gcgctcaaagaataccagattaaaaagaccagagatgtgggtattggcaccaaaaacagc
gaaatcatgacctccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctacctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttagtcccaagcgccataggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatggcagggttacgcattta
aacgaacaggcgcaagggcccatccagtcttcttttgaaatgggggctgatcccaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaagctctttagaaaagcctatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
cttattaccccaagccgttacgacgattttttaagaggcaatcctaaagcgctcagcaaa
gccgaaaaagaggggctgaatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccctatttccataacgggcaattctgggatgttaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttggagccttaaggggtaaaaaacctaaaataatctacccagaactccccata
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system