KEGG   Helicobacter pylori 26695: HP1571Help
Entry
HP1571            CDS       T00008                                 

Definition
rare lipoprotein A RlpA
Orthology
K03642  
rare lipoprotein A
Organism
hpy  Helicobacter pylori 26695
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1651704..1652651)
Genome map
AA seq 315 aa AA seqDB search
MGLALEKVCFLGVIFLISACTVKKEGVKNLSYKHESLRAYENAKDYDPTTKKAAYKRNFF
ERHFKRYSDSQDSNTKDQPLDNGMRDSSSIQRATMRPYQVGGKWYYPTKVDLGEKFDGVA
SWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTVVKVINVDNNLSTIVRINDRGPFVSD
RIIDLSNAAARDIDMVKKGTASVRLIVLGFGGVISTQYEQSFNASSSKILHKEFKVGESE
KSVSGGKFSLQMGAFRNQIGAQTLADKLQAENPNYSVKVAFKDDLYKVLVQGFQSEEEAR
DFMKKYNQNAVLTRE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggcgttggaaaaagtttgttttttaggcgttatttttttgattagcgcttgc
acggttaaaaaagagggggtaaagaatttgtcttacaagcatgaaagcttgcgcgcttat
gaaaacgctaaagattatgatccgacaaccaaaaaagccgcctataaacgcaattttttt
gaacgccatttcaaacgctactccgattcgcaagatagcaacacaaaagatcagccacta
gataacggcatgcgcgattctagctcgatccaaagagccaccatgcgcccttatcaagtg
gggggcaagtggtattaccccactaaagtggatttaggcgaaaaatttgatggcgttgcg
agttggtatggccctaacttccatgccaaaaaaaccagtaatggggaaatttataacatg
tatgcccacaccgccgcgcacaaaactttacccatgaacaccgtggtgaaagtcatcaat
gttgataataacttaagcaccattgtgcgcatcaacgatagagggccttttgtgagcgat
cgcatcattgatttgtctaatgcggccgctagggatattgacatggttaaaaaaggcaca
gccagcgtgcgtctcattgttttgggctttggtggggttatctccacgcaatacgaacaa
tcctttaacgccagctcttcaaagatcttgcacaaggaatttaaagtcggcgagagcgaa
aaaagcgtgagcggagggaaattttctttgcaaatgggggcttttagaaaccaaataggt
gctcaaactttagcggataaattgcaagcagaaaatccaaattacagcgtcaaggttgct
tttaaagacgatttgtataaagttttagttcaagggtttcaaagcgaagaagaggctagg
gattttatgaaaaaatacaaccagaatgcggttttaacgagagaatga

DBGET integrated database retrieval system