KEGG   Helicobacter pylori Aklavik117: HPAKL117_01375Help
Entry
HPAKL117_01375    CDS       T02352                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpya01100  Metabolic pathways
hpya01110  Biosynthesis of secondary metabolites
hpya01130  Biosynthesis of antibiotics
hpya01230  Biosynthesis of amino acids
Module
hpya_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAKL117_01375
Enzymes [BR:hpya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPAKL117_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFX90690
UniProt: K7Z3S2
Position
275847..276404
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTKDCVFVTPDEVLGKLLE
ENTRTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLSVFVETHKQDHTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagaatcatt
tctaaaaccaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaatacccgcaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttgttgcgccgccatgcgagctctttgatt
gtccatcaagatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggtggaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaaacaagaccacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system