KEGG   Helicobacter pylori Aklavik117: HPAKL117_02000Help
Entry
HPAKL117_02000    CDS       T02352                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPAKL117_02000
Enzymes [BR:hpya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPAKL117_02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406195..406686
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
VYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFDRQRKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttatactttaaaaatcatagtaaaattgggaaaattttttcttcgcct
gtttatatcaacccgccttttggttacacgaagcaacctaacttttataacgctacgatt
atccttaaaacatctttaagtttgcgccattttttcgctctggttttttatatagagagg
cgttttgatcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaatcaagtcattttaagacagaacgatctgactttacctcatcctaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system