KEGG   Helicobacter pylori Aklavik117: HPAKL117_03060Help
Entry
HPAKL117_03060    CDS       T02352                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00040  Pentose and glucuronate interconversions
hpya00052  Galactose metabolism
hpya00500  Starch and sucrose metabolism
hpya00520  Amino sugar and nucleotide sugar metabolism
hpya01100  Metabolic pathways
hpya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPAKL117_03060
   00052 Galactose metabolism
    HPAKL117_03060
   00500 Starch and sucrose metabolism
    HPAKL117_03060
   00520 Amino sugar and nucleotide sugar metabolism
    HPAKL117_03060
Enzymes [BR:hpya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPAKL117_03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 P53_C Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFX91023
UniProt: K7YD51
Structure
PDB: 

Jmol
Position
640105..640926
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtagataagcctttaatccaatacgctgta
gaagaagcgatggaggcaggctgtgaagtgatggcgatcgttacaggaagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcaccaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaaacaaatgaaaggcctagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgacgacttatgcataagccatgatcatccaagc
gtgctaaagcaaatgatttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgctccaagcaat
ctagccgtgatagggcgctacattctaaccccggatatttttgaaattttaagcgagacg
aaaccgggcaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcatcgcttaccaattcaagggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system