KEGG   Helicobacter pylori Aklavik117: HPAKL117_04235Help
Entry
HPAKL117_04235    CDS       T02352                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpya03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(875855..876406)
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEAHIEVQGVVYGVQVSMRTSALLQAGQKARLKILQVIKEDAHLLY
GFLEESEKILFERLLKINGVGGRIALAILSSFSPNEFENIIATKEVKRLQQVPGIGKKLA
DKIMVDLIGFFIQDETSPARNEVFLALESLGFKSAEINKVLKTLKPHLSTEAAIKEALQQ
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatctctgctttagaagcgcatatagaa
gtgcaaggggttgtttatggggtgcaagtttctatgcgaacttctgctttgctccaagcg
ggccaaaaagcgcgtttgaaaatcttacaagtgattaaagaagatgcgcatcttttatac
gggtttttagaagagagcgaaaaaatcctctttgaaaggcttttaaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagcttttcgccgaatgaatttgaaaacatt
atcgccactaaagaagtcaaaagactccaacaagtcccaggcataggcaaaaagctcgct
gataagatcatggtggatttgattggttttttcattcaagatgaaaccagccctgcacgc
aatgaagtctttttagccctagagagtttgggctttaaaagcgctgaaatcaataaagtt
ttaaaaaccctaaaaccccatctcagcaccgaagcagcgattaaagaagccttacaacaa
ctgcgctcttaa

DBGET integrated database retrieval system