KEGG   Helicobacter pylori Aklavik117: HPAKL117_04420Help
Entry
HPAKL117_04420    CDS       T02352                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPAKL117_04420 (recR)
DNA repair and recombination proteins [BR:hpya03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HPAKL117_04420 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929622..930203
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CASCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaaatccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgctcaagatcacgcacgctttagagaacgccctagaaaaccttaaaaca
tgtgcatcttgtaacgcgctcagtgagagtgaggtttgtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaggat
ttaaaggattttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctttatattgaagataagttgcagcatttccatctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system