KEGG   Helicobacter pylori Aklavik117: HPAKL117_05190Help
Entry
HPAKL117_05190    CDS       T02352                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00010  Glycolysis / Gluconeogenesis
hpya00020  Citrate cycle (TCA cycle)
hpya00620  Pyruvate metabolism
hpya00640  Propanoate metabolism
hpya00650  Butanoate metabolism
hpya00680  Methane metabolism
hpya01100  Metabolic pathways
hpya01120  Microbial metabolism in diverse environments
hpya01130  Biosynthesis of antibiotics
hpya01200  Carbon metabolism
Module
hpya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAKL117_05190
   00020 Citrate cycle (TCA cycle)
    HPAKL117_05190
   00620 Pyruvate metabolism
    HPAKL117_05190
   00640 Propanoate metabolism
    HPAKL117_05190
   00650 Butanoate metabolism
    HPAKL117_05190
  Energy metabolism
   00680 Methane metabolism
    HPAKL117_05190
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPAKL117_05190
Enzymes [BR:hpya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPAKL117_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFX91432
UniProt: K7YT19
Position
1096495..1097055
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMEPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgctatcaccggtgctaaaggg
ctggctgatgtgatttcaaaaacaggtaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatggagcctgattatgtgctggtgattgacccgggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcactagctatcttaac
aaagaagaattgtttgaaaaaaaacccgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccctaaaacgccccatccctaacacgcccatgctagga
gcgttaatgaaagtgtctggcatgcttgaaatcggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system