KEGG   Helicobacter pylori Aklavik117: HPAKL117_07400Help
Entry
HPAKL117_07400    CDS       T02352                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00220  Arginine biosynthesis
hpya00330  Arginine and proline metabolism
hpya01100  Metabolic pathways
hpya01110  Biosynthesis of secondary metabolites
hpya01130  Biosynthesis of antibiotics
hpya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPAKL117_07400
   00330 Arginine and proline metabolism
    HPAKL117_07400
Enzymes [BR:hpya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPAKL117_07400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFX91859
UniProt: K7Y7D5
Structure
PDB: 

Jmol
Position
complement(1527858..1528820)
Genome map
AA seq 320 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIVQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLGAVEVTEYNPTVSAKHTDEEEKQVLE
ILDLIINSCKIKDNNLGQAL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagccttaagtgcaacgcatggcgatgtgattaaaggcatgcaa
acaatcgttcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttaatcttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttgggcatggtt
ttaaatcgtgtccgtagcgggtttaaccgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgagttgaag
caattactgggcttgcttttagaaagctttaaagacagattaggagccgttgaggtaacc
gaatacaaccccacggtgagcgcaaaacacaccgacgaagaagaaaagcaagttttagag
atattagatctcatcatcaatagctgtaaaattaaagataataatttaggccaagcgctt
tga

DBGET integrated database retrieval system