KEGG   Helicobacter pylori UM037: K750_03890Help
Entry
K750_03890        CDS       T02659                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hpyi  Helicobacter pylori UM037
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K750_03890
  Amino acid metabolism
   00380 Tryptophan metabolism
    K750_03890
Enzymes [BR:hpyi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     K750_03890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833668..834612
Genome map
AA seq 314 aa AA seqDB search
MKKIGLSLCLVLSLGFLKAHEVSAEEIADIFYKLNAKEPKMKINHTKGFCAKGVFLPNLQ
AREDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLENQNASWTMVMLNTEINFA
KNPKEFAQFFEMRIPKNGKVDEARIKKLYEEVPSYRNFAAYTKTIGISSSVANTPYYSVH
AFRFKDKKEELLPARWKFVPKDGVKYLNPQELKQKDSNYLLSSFQQHLKNKPIEYQMYLV
FANKNDATNDTTALWKGKHKELLVGTLKVEKYEGMGCNKDVYFPADLPKGVEAPTDPLFQ
IRNEVYGITFSRRQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggtttgagtttgtgtttggttttgagtttgggttttttaaaagcccat
gaagtgagcgctgaagagattgcggatattttctacaagctcaacgccaaagagcctaaa
atgaaaatcaaccacactaaggggttttgcgctaaaggcgtgttcctccctaatttgcaa
gcgagagaggatttagatgtgccactactcaatgaaaaagaaatccctgcgtctgtaagg
tattctttagggggcgtagcgatggacgataaaagcaaagttaggggaatggcgttaaaa
ttggaaaatcaaaacgctagctggacaatggtgatgctcaatacagaaatcaattttgcc
aaaaaccctaaagaattcgctcaattttttgagatgaggattcctaaaaatggcaaggta
gatgaagcaagaatcaaaaagctttatgaagaagtcccttcttataggaattttgccgct
tacaccaaaacgatagggattagctcaagcgtggctaacacgccttattatagcgtgcat
gcgttcaggtttaaagataagaaagaggaattattgcctgcgagatggaaatttgtgcct
aaagacggcgttaagtatcttaacccccaagaattaaagcaaaaagattcaaattatctg
ctttcttcattccaacaacaccttaaaaataaacccatagaataccaaatgtatctggtg
tttgcaaataaaaatgatgccaccaacgacacgaccgcgctttggaaaggtaaacacaag
gaattattggtggggaccttgaaagttgaaaaatacgaaggaatgggttgcaataaagat
gtgtatttcccagccgatctccctaaaggcgtagaagcccctactgatcccttgtttcaa
atcagaaatgaagtttatgggatcacttttagcaggaggcaataa

DBGET integrated database retrieval system