KEGG   Helicobacter pylori UM037: K750_07345Help
Entry
K750_07345        CDS       T02659                                 

Definition
disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpyi  Helicobacter pylori UM037
Brite
Enzymes [BR:hpyi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     K750_07345
Secretion system [BR:hpyi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   K750_07345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
116571..117368
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVSLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSEDVQLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagtgcattacttcttgtaagcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacagaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatatcccgcttgtagtgagt
aaggatggtaatttaatcatagggcttagcaatatcttttttagcaataaaagcgaagat
gtgcaattagtcgcagaaaccaatcaaaaaatccaagcccttaacgccacccagcaaaac
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgcaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaagcttagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcagctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcaagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaatactactaaaaagatttttgaatctggcgtgatcaagggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system