KEGG   Helicobacter pylori Aklavik86: HPAKL86_00840Help
Entry
HPAKL86_00840     CDS       T02353                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpyk  Helicobacter pylori Aklavik86
Brite
Enzymes [BR:hpyk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPAKL86_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(160946..161998)
Genome map
AA seq 350 aa AA seqDB search
MKKTILLSAFLAFSCTHALSDMDLIKKARESQLEPMPMGKELKDYQIKKTKDVGIGTKKN
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
TKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPLGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALKGKKPKILYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagaccattttattgagcgcctttttagccttttcttgcactcatgctttaagc
gatatggatttgatcaaaaaagcgagagaaagccaactagaacccatgcctatgggcaaa
gagctcaaagactaccagattaaaaaaactaaagatgtgggtattggcactaagaaaaac
gagatcatgacccccgctcaagtggaattaggcaaaatgctctactttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttagtcccaagcgctgtaggttctcaatggaagaaaaaccctcaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatgggagggttacgcactta
aacgaacaagcgcaagggcccatccagtcttcttttgaaatgggggctgatcctaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaactctttagaaaagcttatggc
actaaagtcaaaattgattttaaattgatcgccgatagtatcgctatgtttgaagccacg
ctcatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgtcataacggc
attaatcttgggggaacgatgcagcctcttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattctgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagctttaaagggtaaaaaacctaaaatactctatccagaactccctgta
atgacagacaaaacccctaaaccctctttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system