KEGG   Helicobacter pylori Aklavik86: HPAKL86_01650Help
Entry
HPAKL86_01650     CDS       T02353                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00300  Lysine biosynthesis
hpyk01100  Metabolic pathways
hpyk01120  Microbial metabolism in diverse environments
hpyk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPAKL86_01650
Enzymes [BR:hpyk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPAKL86_01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFX89347
UniProt: K7YLW9
Position
complement(315459..316610)
Genome map
AA seq 383 aa AA seqDB search
MDVLEITQKLISYPTITPKECGIFEYIKSLFPTFKALECGENGVKNLFLYRVFNPQKEHA
KKEHAKENVKPLHFCFAGHIDVVPPGNNWQSDPFKPLIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFMLSVLLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEKVLGDS
IKIGRRGSINGKLILKGTQGHVAYPQKCQNPIDSLASVLPLISGVNLDDGDEYFDPSKLV
ITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKNAPHTLELESSSSPFI
TASHSKLASVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDER
VSLKELEFLEKVFLGVLEDLSEK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacgttttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctacttttaaagctctagagtgtggg
gaaaatggcgtgaaaaacctttttttataccgggtttttaacccccaaaaagagcatgca
aaaaaagagcatgcaaaagaaaatgttaagcccttgcacttttgctttgcagggcatatt
gatgtcgtgcctcctggaaacaactggcaaagcgatccctttaaaccccttattaaagag
gggtttttatacggccgtggggcgcaagacatgaaaggaggcgtgggggcgtttttgagc
gcgagtttaaattttaaccctaaaacccctttcatgctttctgttttactcacaagcgat
gaagaagggccagggatttttggcactaggcttatgttagaaaaactcaaagaaaaagat
ttgctccctcacatggcgattgtggctgaacccacttgcgaaaaagtcctaggcgatagc
atcaaaatcggccgaagaggctccattaatggcaaactcattttaaaaggcactcaaggg
catgtagcttacccgcaaaaatgccaaaaccccattgattcgctcgcttctgttttgccc
ttgatttcaggagttaatttagacgatggcgatgaatattttgacccttcaaaattggtt
atcaccaacttgcatgcagggttaggagcgaataatgtaacgcccgcaagcgtagagatc
atctttaatgcgcgccattctttaaaaaccaccaaagagagtttgaaagaatatttagaa
aaagttttaaaaaacgcgcctcacactttagaattagaatcaagcagttcgcctttcatc
acggcttctcattcaaagcttgccagcgttttaaaagaaaatattttaaaaacatgccat
accaccccccttttaaacaccaaaggcggcacgagcgatgcgcgattctttagcgctcat
ggcatagaagtagtggaatttggcgttattaatgacagaatccatgccattgatgaaagg
gtgagcttgaaagaattagagtttttagaaaaagtgtttttgggagttttagaggatttg
agcgagaaatag

DBGET integrated database retrieval system