KEGG   Helicobacter pylori Aklavik86: HPAKL86_01670Help
Entry
HPAKL86_01670     CDS       T02353                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hpyk00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321043..322143
Genome map
AA seq 366 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVKIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNAL
EPLGAKVFVGLEGIDAMVEECVSNLVINAIVGVAGLRASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLELIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLASTDMQLPISYAIDPKLASLNASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAIEKFLNKEIAFGGLIKTISQALELYAKMPFKLSNLDEVLALDKEVRE
RFGNYR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgctctaaaaatcgcaaaaaaa
ttcaaggtaaaaatagaagccttaagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacctaagaaagtggcgattttagatcctaacgatttgaatgcatta
gagcctttgggcgcgaaagtgtttgtagggctagagggcattgatgcgatggtagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggcgggactaagggcgagcttt
aaaagcttgcaaactaacaaaaaactagccctagcgaataaagaaagcttggtgagcgct
gggcatttattagacatttcacaaatcacgcccattgatagcgagcattttggtttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagcgcaagtgggggg
gctttcagggacacgcctttagaactcattcctattcaaaacgcgcaaaacgcactcaag
caccctaattggagcatgggatctaaaatcactattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacttattggctttttggcgcgtctttaaagattgatgcactg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagataattctatcatcgcg
catttagcaagcacggacatgcaattacccataagctatgcgatcgatccgaagttggcc
tctttgaatgcgtctatcaagcccctagacttatacgctttaagcgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaagtagcgatagagaagtttttaaacaaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaattatacgctaaa
atgcctttcaagctctctaatttagatgaagtgctggcgttggataaagaagttagggag
cggtttggaaattataggtag

DBGET integrated database retrieval system