KEGG   Helicobacter pylori Aklavik86: HPAKL86_01740Help
Entry
HPAKL86_01740     CDS       T02353                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPAKL86_01740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPAKL86_01740
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPAKL86_01740
Enzymes [BR:hpyk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPAKL86_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(336401..337861)
Genome map
AA seq 486 aa AA seqDB search
MPFAPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLQWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLADMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNDALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIEMG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
STTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFEKGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgcccccacccgttctttgaaagaaaaaaagattgattttattgaagcgata
ttaaaccccaacgccccaaaaggcgggctttacactctagagcattttgaaacattacaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggtta
ggattagagattcctaagggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcactcaatgaaaggcttttcgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggctttacagcctttagcgagcttgttt
tctaatctggcggtaggaaaaaatgaaaagtatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcggacatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgacgctttaaaagcgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgcattaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaatgggg
cgttacgatttaacccatcgttctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgctaccgctttaaacgcc
agcttgaaaactaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agcaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagatagccagcgccttgatgatttatttgag
aaaggaatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system